PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012572501.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 340aa    MW: 38330.2 Da    PI: 6.6333
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012572501.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.84.3e-27269319152
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                     k+r++W+peLH+rFv+a+++LGGs+ AtPk+i+elm+v+gLt+++vkSHLQ 
  XP_012572501.1 269 KQRRCWSPELHRRFVSALQKLGGSQ-ATPKQIRELMQVDGLTNDEVKSHLQV 319
                     79*******************9987.*************************4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.252266325IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-24266318IPR009057Homeodomain-like
SuperFamilySSF466895.29E-15266321IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-24269322IPR006447Myb domain, plants
PfamPF002491.6E-6271318IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGSLPSELTL DLRPTFLPKT ISDFLLDLSS IQPTSDKLSK LHDFLSRLED ELKKIDAFKR  60
ELPLCMFLLN DAILVLKEEL EKCRVQNSLP VLEEFIPLKK EIDQSEENNN DDDDNNNNEC  120
RDKMNWMSSV QLWNNNNTTT NNNASDQKHN HNKLETKKME EEEQSVTVAE EPIFQPCSSN  180
RNGGSAFMPF STYSSVPVTT VTLAAPKQEK EDTVINRLSL LTPGMKSLRE GFGSRGSRGS  240
SSRAVSSSPP TVHPSLRAGP LQPQQTSRKQ RRCWSPELHR RFVSALQKLG GSQATPKQIR  300
ELMQVDGLTN DEVKSHLQVS FRNTGFIHGE VRPQVVISLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572501.10.0PREDICTED: uncharacterized protein DDB_G0286379 isoform X4
TrEMBLA0A072UMN01e-153A0A072UMN0_MEDTR; Myb-like transcription factor family protein
STRINGVIT_03s0063g01060.t011e-115(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-38G2-like family protein